PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sof021186
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Saccharinae; Saccharum; Saccharum officinarum complex
Family MYB_related
Protein Properties Length: 146aa    MW: 17079.8 Da    PI: 7.8796
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Sof#S17476506PU_refUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding25.14e-0878116141
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqck 41 
                      rg+W++ + +l++++ +q+G++ ++ I + ++  +t+ q++
        Sof021186  78 RGKWSKSDTDLFYEGLRQFGSD-FAMIQQLFP-DKTRHQVR 116
                      89********************.*********.******98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.05E-971117IPR009057Homeodomain-like
PfamPF159631.4E-2171138No hitNo description
SMARTSM007171.8E-577125IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.8E-478117IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 146 aa     Download sequence    Send to blast
MKLSAAHLRL LQEARARVNP KETPSGPSSN TRSFELEDMD DLDYRDEEAR FFDNDGTENH  60
VQNATKLNYQ SYMNKPARGK WSKSDTDLFY EGLRQFGSDF AMIQQLFPDK TRHQVRQXIK  120
SEEKKKPLLV HDAIIHRSGD NLYLQR
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Sof.237610.0callus| crown| root
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008646029.12e-83PREDICTED: uncharacterized protein LOC103627515 isoform X2
TrEMBLC5YME65e-83C5YME6_SORBI; Putative uncharacterized protein Sb07g001792 (Fragment)
STRINGSb07g001792.11e-82(Sorghum bicolor)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G39160.24e-26MYB_related family protein